General Information

  • ID:  hor000949
  • Uniprot ID:  Q9TS44
  • Protein name:  Cholecystokinin-18
  • Gene name:  CCK
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  LDPSHRISDRDYMGWMDF
  • Length:  18
  • Propeptide:  AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
  • Signal peptide:  NA
  • Modification:  T12 Sulfotyrosine;T18 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKAR
  • Target Unid:  Q5D0K2
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TS44-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000949_AF2.pdbhor000949_ESM.pdb

Physical Information

Mass: 254489 Formula: C98H141N27O30S2
Absent amino acids: ACEKNQTV Common amino acids: D
pI: 4.45 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -95 Boman Index: -5553
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 5618.89 Extinction Coefficient cystines: 6990
Absorbance 280nm: 411.18

Literature

  • PubMed ID:  2430967
  • Title:  New Molecular Forms of Cholecystokinin. Microsequence Analysis of Forms Previously Characterized by Chromatographic Methods